PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G130000.1.p
Common NameGLYMA_06G130000, LOC102667519
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 312aa    MW: 35554.8 Da    PI: 7.5281
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G130000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK74.91e-23204251552
               RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +++++++k+F  pi++AAk L+v+lT+LKr+CR++ I RWPhRk+ksl
  Glyma.06G130000.1.p 204 LEFDEIKKHFGVPITEAAKRLNVGLTMLKRRCRELSITRWPHRKLKSL 251
                          899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.415191273IPR003035RWP-RK domain
PfamPF020421.4E-21204251IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGFVFVSDRD FPNLDNVPHT FTSSFSFAQL NHTHKIMEVS PLEGFSELDW WTPQLPYSSN  60
HLCFNEFPDL ENLDLDFSLP SLGEHLEEVD QKPSNIVVPE GLRCNHEKVF GDALLATEHV  120
SATCVKKEQV LNNIDQSPLP VLLASNSTTR KKPCALEFEE ASFAIQNQNG SATASYLKKE  180
EVQNIIHQRP LPVSSSSKKR TCVLEFDEIK KHFGVPITEA AKRLNVGLTM LKRRCRELSI  240
TRWPHRKLKS LQLLIDNVKE MGLEDEVPRL ERQKRLLEKL PGLELSEEAK KLRQACFKAN  300
YKKRRCMALQ S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1883703e-43AC188370.9 Glycine max cultivar PI 96983 clone gmp1-120k16, complete sequence.
GenBankAP0150353e-43AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581653.10.0PREDICTED: protein RKD5-like
TrEMBLK7KUT40.0K7KUT4_SOYBN; Uncharacterized protein
STRINGGLYMA06G13540.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-35RWP-RK domain-containing protein